Lineage for d1fs5b_ (1fs5 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849026Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 849027Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families) (S)
  5. 849028Family c.124.1.1: NagB-like [52513] (2 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 849033Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 849034Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 849040Domain d1fs5b_: 1fs5 B: [65045]
    complexed with 16g, tar

Details for d1fs5b_

PDB Entry: 1fs5 (more details), 1.73 Å

PDB Description: a discovery of three alternate conformations in the active site of glucosamine-6-phosphate isomerase
PDB Compounds: (B:) glucosamine-6-phosphate deaminase

SCOP Domain Sequences for d1fs5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs5b_ c.124.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOP Domain Coordinates for d1fs5b_:

Click to download the PDB-style file with coordinates for d1fs5b_.
(The format of our PDB-style files is described here.)

Timeline for d1fs5b_: