SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1fs5a_ (1fs5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2150965Family c.124.1.1: NagB-like [52513] (3 protein domains)
    share a common phosphate-binding site with the RpiA family
  6. 2150970Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 2150971Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 2150976Domain d1fs5a_: 1fs5 A: [65044]
    complexed with 16g, tla

Details for d1fs5a_

PDB Entry: 1fs5 (more details), 1.73 Å

PDB Description: a discovery of three alternate conformations in the active site of glucosamine-6-phosphate isomerase
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d1fs5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs5a_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOPe Domain Coordinates for d1fs5a_:

Click to download the PDB-style file with coordinates for d1fs5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fs5a_: