SCOP 1.75: Domain d1fqob_: 1fqo B:

Lineage for d1fqob_ (1fqo B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families)

5. Family c.124.1.1: NagB-like [52513] (2 proteins)
   share a common phosphate-binding site with the RpiA family

6. Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)

7. Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)

8. Domain d1fqob_: 1fqo B: [65040]
   complexed with fpc

Details for d1fqob_

PDB Entry: 1fqo, 2.2 Å

PDB Description: glucosamine 6-phosphate deaminase complexed with the substrate of the reverse reaction fructose 6-phosphate (open form)

PDB Compounds: (B:) glucosamine-6-phosphate deaminase

SCOP Domain Sequences for d1fqob_:

Sequence; same for both SEQRES and ATOM records:

>d1fqob_ c.124.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

Timeline for d1fqob_:

• d1fqob_ first appeared in SCOP 1.59
  
• d1fqob_ appears in SCOP 1.73
  
• d1fqob_ appears in SCOPe 2.01
  
• d1fqob_ appears in the current release, SCOPe 2.08