SCOP 1.59: Domain d1fqoa_: 1fqo A:

Lineage for d1fqoa_ (1fqo A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily)

4. Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family)

5. Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)

6. Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)

7. Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)

8. Domain d1fqoa_: 1fqo A: [65039]

Details for d1fqoa_

PDB Entry: 1fqo, 2.2 Å

PDB Description: glucosamine 6-phosphate deaminase complexed with the substrate of the reverse reaction fructose 6-phosphate (open form)

SCOP Domain Sequences for d1fqoa_:

Sequence; same for both SEQRES and ATOM records:

>d1fqoa_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

Timeline for d1fqoa_:

• d1fqoa_ is new in SCOP 1.59
  
• d1fqoa_ appears in SCOP 1.61
  
• d1fqoa_ appears in the current release, SCOPe 2.08