Lineage for d1foja_ (1foj A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878765Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 878766Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 878767Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 878768Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 878774Species Cow (Bos taurus) [TaxId:9913] [56517] (40 PDB entries)
    Uniprot P29473 67-482
  8. 878827Domain d1foja_: 1foj A: [65037]

Details for d1foja_

PDB Entry: 1foj (more details), 2.1 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 7-nitroindazole-2-carboxamidine (h4b present)
PDB Compounds: (A:) Nitric-oxide synthase

SCOP Domain Sequences for d1foja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foja_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOP Domain Coordinates for d1foja_:

Click to download the PDB-style file with coordinates for d1foja_.
(The format of our PDB-style files is described here.)

Timeline for d1foja_: