Lineage for d1fm7b_ (1fm7 B:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.36: Chalcone isomerase [54625] (1 superfamily) Superfamily d.36.1: Chalcone isomerase [54626] (1 family) 
Family d.36.1.1: Chalcone isomerase [54627] (1 protein) Protein Chalcone isomerase [54628] (1 species) Species Alfalfa (Medicago sativa) [TaxId:3879] [54629] (5 PDB entries) 
Domain d1fm7b_: 1fm7 B: [65033]
Details for d1fm7b_
PDB Entry: 1fm7 (more details), 2.3 Å
PDB Description: chalcone isomerase complexed with 5-deoxyflavanone
SCOP Domain Sequences for d1fm7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fm7b_ d.36.1.1 (B:) Chalcone isomerase {Alfalfa (Medicago sativa)}
sitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasla
akwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgt
ygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkav
ssavletmigehavspdlkrclaarlpallne
SCOP Domain Coordinates for d1fm7b_:
Click to download the PDB-style file with coordinates for d1fm7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fm7b_:
- d1fm7b_ is new in SCOP 1.59
- d1fm7b_ appears in SCOP 1.61
- d1fm7b_ appears in the current release, SCOPe 2.08
View in 3D
