Lineage for d1flha_ (1flh A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) 
Protein Pepsin(ogen) [50658] (4 species) 
Species Human (Homo sapiens), 3A [TaxId:9606] [50660] (4 PDB entries) 
Domain d1flha_: 1flh A: [65031]
Details for d1flha_
PDB Entry: 1flh (more details), 2.45 Å
PDB Description: crystal structure of human uropepsin at 2.45 a resolution
SCOP Domain Sequences for d1flha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flha_ b.50.1.2 (A:) Pepsin(ogen) {Human (Homo sapiens), 3A}
vdeqplenyldmeyfgtigigtpaqdftvvfdtgssnlwvpsvycsslactnhnrfnped
sstyqstsetvsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisssgatpvfdniwnqglvsqdlfsvylsaddqsgsvvifggidssyytgsln
wvpvtvegywqitvdsitmngeaiacaegcqaivdtgtslltgptspianiqsdigasen
sdgdmvvscsaisslpdivftingvqypvppsayilqsegscisgfqgmnvptesgelwi
lgdvfirqyftvfdrannqvglapva
SCOP Domain Coordinates for d1flha_:
Click to download the PDB-style file with coordinates for d1flha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1flha_:
- d1flha_ is new in SCOP 1.59
- d1flha_ appears in SCOP 1.61
- d1flha_ appears in the current release, SCOPe 2.08
View in 3D