Lineage for d1fl6h2 (1fl6 H:114-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289104Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289162Domain d1fl6h2: 1fl6 H:114-213 [65028]
    Other proteins in same PDB: d1fl6a1, d1fl6a2, d1fl6b1, d1fl6h1, d1fl6l1, d1fl6l2

Details for d1fl6h2

PDB Entry: 1fl6 (more details), 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4

SCOP Domain Sequences for d1fl6h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl6h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1fl6h2:

Click to download the PDB-style file with coordinates for d1fl6h2.
(The format of our PDB-style files is described here.)

Timeline for d1fl6h2: