Lineage for d1fl6h1 (1fl6 H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 103133Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69139] (2 PDB entries)
  8. 103140Domain d1fl6h1: 1fl6 H:1-113 [65027]
    Other proteins in same PDB: d1fl6a2, d1fl6b2, d1fl6h2, d1fl6l2

Details for d1fl6h1

PDB Entry: 1fl6 (more details), 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4

SCOP Domain Sequences for d1fl6h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl6h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvss

SCOP Domain Coordinates for d1fl6h1:

Click to download the PDB-style file with coordinates for d1fl6h1.
(The format of our PDB-style files is described here.)

Timeline for d1fl6h1: