SCOP 1.73: Domain d1fl6b2: 1fl6 B:114-213

Lineage for d1fl6b2 (1fl6 B:114-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1fl6b2: 1fl6 B:114-213 [65026]
   Other proteins in same PDB: d1fl6a1, d1fl6a2, d1fl6b1, d1fl6h1, d1fl6l1, d1fl6l2
   part of humanized catalytic Fab 28b4 with a sulfide oxidase activity
   complexed with aah; mutant

Details for d1fl6b2

PDB Entry: 1fl6, 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4

PDB Compounds: (B:) antibody germline precursor to 28b4

SCOP Domain Sequences for d1fl6b2:

Sequence; same for both SEQRES and ATOM records:

>d1fl6b2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1fl6b2:

• d1fl6b2 first appeared in SCOP 1.59
  
• d1fl6b2 appears in SCOP 1.71
  
• d1fl6b2 appears in SCOP 1.75
  
• d1fl6b2 appears in the current release, SCOPe 2.08