SCOP 1.59: Domain d1fl6b1: 1fl6 B:1-113

Lineage for d1fl6b1 (1fl6 B:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69139] (2 PDB entries)

8. Domain d1fl6b1: 1fl6 B:1-113 [65025]
   Other proteins in same PDB: d1fl6a2, d1fl6b2, d1fl6h2, d1fl6l2

Details for d1fl6b1

PDB Entry: 1fl6, 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4

SCOP Domain Sequences for d1fl6b1:

Sequence; same for both SEQRES and ATOM records:

>d1fl6b1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvss

Timeline for d1fl6b1:

• d1fl6b1 is new in SCOP 1.59
  
• d1fl6b1 appears in SCOP 1.61
  
• d1fl6b1 appears in the current release, SCOPe 2.07