Lineage for d1fl6a2 (1fl6 A:108-212)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289677Domain d1fl6a2: 1fl6 A:108-212 [65024]
    Other proteins in same PDB: d1fl6a1, d1fl6b1, d1fl6b2, d1fl6h1, d1fl6h2, d1fl6l1
    part of humanized catalytic Fab Fab 28b4 with a sulfide oxidase activity
    complexed with aah; mutant

Details for d1fl6a2

PDB Entry: 1fl6 (more details), 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4

SCOP Domain Sequences for d1fl6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl6a2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1fl6a2:

Click to download the PDB-style file with coordinates for d1fl6a2.
(The format of our PDB-style files is described here.)

Timeline for d1fl6a2: