Lineage for d1fl5l2 (1fl5 L:108-212)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516306Domain d1fl5l2: 1fl5 L:108-212 [65022]
    Other proteins in same PDB: d1fl5a1, d1fl5b1, d1fl5b2, d1fl5h1, d1fl5h2, d1fl5l1
    part of humanized catalytic Fab 28b4 with a sulfide oxidase activity
    complexed with so4

Details for d1fl5l2

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.
PDB Compounds: (L:) antibody germline precursor to antibody 28b4

SCOPe Domain Sequences for d1fl5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1fl5l2:

Click to download the PDB-style file with coordinates for d1fl5l2.
(The format of our PDB-style files is described here.)

Timeline for d1fl5l2: