![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (134 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
![]() | Domain d1fl5l2: 1fl5 L:108-212 [65022] Other proteins in same PDB: d1fl5a1, d1fl5b1, d1fl5b2, d1fl5h1, d1fl5h2, d1fl5l1 part of humanized catalytic Fab 28b4 with a sulfide oxidase activity complexed with so4 |
PDB Entry: 1fl5 (more details), 2.1 Å
SCOPe Domain Sequences for d1fl5l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl5l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1fl5l2: