Lineage for d1fl5l2 (1fl5 L:108-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104576Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69150] (2 PDB entries)
  8. 104580Domain d1fl5l2: 1fl5 L:108-212 [65022]
    Other proteins in same PDB: d1fl5a1, d1fl5b1, d1fl5h1, d1fl5l1

Details for d1fl5l2

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.
PDB Compounds: (L:)

SCOP Domain Sequences for d1fl5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5l2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1fl5l2:

Click to download the PDB-style file with coordinates for d1fl5l2.
(The format of our PDB-style files is described here.)

Timeline for d1fl5l2: