SCOP 1.75: Domain d1fl5h2: 1fl5 H:114-213

Lineage for d1fl5h2 (1fl5 H:114-213)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
SQ NA # humanized antibody
Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
SQ NA # engineered antibody
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

Domain d1fl5h2: 1fl5 H:114-213 [65020]
Other proteins in same PDB: d1fl5a1, d1fl5a2, d1fl5b1, d1fl5h1, d1fl5l1, d1fl5l2
part of humanized catalytic Fab 28b4 with a sulfide oxidase activity

Details for d1fl5h2

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

PDB Compounds: (H:) antibody germline precursor to antibody 28b4

SCOP Domain Sequences for d1fl5h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1fl5h2:

Click to download the PDB-style file with coordinates for d1fl5h2.
(The format of our PDB-style files is described here.)

Timeline for d1fl5h2: