SCOP 1.63: Domain d1fl5h2: 1fl5 H:114-213

Lineage for d1fl5h2 (1fl5 H:114-213)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69150] (2 PDB entries)
Domain d1fl5h2: 1fl5 H:114-213 [65020]
Other proteins in same PDB: d1fl5a1, d1fl5b1, d1fl5h1, d1fl5l1

Details for d1fl5h2

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

SCOP Domain Sequences for d1fl5h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5h2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1fl5h2:

Click to download the PDB-style file with coordinates for d1fl5h2.
(The format of our PDB-style files is described here.)

Timeline for d1fl5h2: