SCOP 1.59: Domain d1fl5h2: 1fl5 H:114-213

Lineage for d1fl5h2 (1fl5 H:114-213)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69150] (2 PDB entries)

8. Domain d1fl5h2: 1fl5 H:114-213 [65020]
   Other proteins in same PDB: d1fl5a1, d1fl5b1, d1fl5h1, d1fl5l1

Details for d1fl5h2

PDB Entry: 1fl5, 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

SCOP Domain Sequences for d1fl5h2:

Sequence; same for both SEQRES and ATOM records:

>d1fl5h2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1fl5h2:

• d1fl5h2 is new in SCOP 1.59
  
• d1fl5h2 appears in SCOP 1.61
  
• d1fl5h2 appears in the current release, SCOPe 2.08