Lineage for d1fl5b1 (1fl5 B:1-113)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546690Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)
  8. 546715Domain d1fl5b1: 1fl5 B:1-113 [65017]
    Other proteins in same PDB: d1fl5a1, d1fl5a2, d1fl5b2, d1fl5h2, d1fl5l1, d1fl5l2
    part of humanized catalytic Fab 28b4 with a sulfide oxidase activity
    complexed with so4; mutant

Details for d1fl5b1

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

SCOP Domain Sequences for d1fl5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvss

SCOP Domain Coordinates for d1fl5b1:

Click to download the PDB-style file with coordinates for d1fl5b1.
(The format of our PDB-style files is described here.)

Timeline for d1fl5b1: