Lineage for d1fl5b1 (1fl5 B:1-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220237Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69139] (2 PDB entries)
  8. 220239Domain d1fl5b1: 1fl5 B:1-113 [65017]
    Other proteins in same PDB: d1fl5a2, d1fl5b2, d1fl5h2, d1fl5l2
    complexed with so4; mutant

Details for d1fl5b1

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

SCOP Domain Sequences for d1fl5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5b1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvss

SCOP Domain Coordinates for d1fl5b1:

Click to download the PDB-style file with coordinates for d1fl5b1.
(The format of our PDB-style files is described here.)

Timeline for d1fl5b1: