SCOP 1.65: Domain d1fl5a1: 1fl5 A:1-107

Lineage for d1fl5a1 (1fl5 A:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)

8. Domain d1fl5a1: 1fl5 A:1-107 [65015]
   Other proteins in same PDB: d1fl5a2, d1fl5b1, d1fl5b2, d1fl5h1, d1fl5h2, d1fl5l2
   part of humanized catalytic Fab Fab 28b4 with a sulfide oxidase activity
   complexed with so4; mutant

Details for d1fl5a1

PDB Entry: 1fl5, 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

SCOP Domain Sequences for d1fl5a1:

Sequence; same for both SEQRES and ATOM records:

>d1fl5a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleik

Timeline for d1fl5a1:

• d1fl5a1 first appeared in SCOP 1.59
  
• d1fl5a1 appears in SCOP 1.63
  
• d1fl5a1 appears in SCOP 1.67
  
• d1fl5a1 appears in the current release, SCOPe 2.08