| Class b: All beta proteins [48724] (110 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
| Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69139] (2 PDB entries) |
| Domain d1fl5a1: 1fl5 A:1-107 [65015] Other proteins in same PDB: d1fl5a2, d1fl5b2, d1fl5h2, d1fl5l2 |
PDB Entry: 1fl5 (more details), 2.1 Å
SCOP Domain Sequences for d1fl5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl5a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleik
Timeline for d1fl5a1: