Lineage for d1fj0d_ (1fj0 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 2303657Protein Cytochrome c2 [46650] (8 species)
  7. 2303678Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)
  8. 2303684Domain d1fj0d_: 1fj0 D: [65014]
    complexed with gol, hem, so4

Details for d1fj0d_

PDB Entry: 1fj0 (more details), 1.7 Å

PDB Description: structure determination of the ferricytochrome c2 from rhodopseudomonas palustris
PDB Compounds: (D:) cytochrome c2

SCOPe Domain Sequences for d1fj0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj0d_ a.3.1.1 (D:) Cytochrome c2 {Rhodopseudomonas palustris [TaxId: 1076]}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

SCOPe Domain Coordinates for d1fj0d_:

Click to download the PDB-style file with coordinates for d1fj0d_.
(The format of our PDB-style files is described here.)

Timeline for d1fj0d_: