SCOP 1.73: Domain d1fcva_: 1fcv A:

Lineage for d1fcva_ (1fcv A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.9: Bee venom hyaluronidase [69387] (1 protein)
   distorted barrel lacks the second strand

6. Protein Bee venom hyaluronidase [69388] (1 species)

7. Species Honeybee (Apis mellifera) [TaxId:7460] [69389] (4 PDB entries)

8. Domain d1fcva_: 1fcv A: [65008]
   complexed with gcu, nag

Details for d1fcva_

PDB Entry: 1fcv, 2.65 Å

PDB Description: crystal structure of bee venom hyaluronidase in complex with hyaluronic acid tetramer

PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOP Domain Sequences for d1fcva_:

Sequence; same for both SEQRES and ATOM records:

>d1fcva_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera) [TaxId: 7460]}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng
nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy
kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc
ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal
riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint
kakclqfreylnnelgpavkrial

Timeline for d1fcva_:

• d1fcva_ first appeared in SCOP 1.59
  
• d1fcva_ appears in SCOP 1.71
  
• d1fcva_ appears in SCOP 1.75
  
• d1fcva_ appears in the current release, SCOPe 2.08