Lineage for d1fcqa_ (1fcq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083536Family c.1.8.9: Bee venom hyaluronidase [69387] (2 protein domains)
    distorted barrel lacks the second strand
    automatically mapped to Pfam PF01630
  6. 2083537Protein Bee venom hyaluronidase [69388] (1 species)
  7. 2083538Species Honeybee (Apis mellifera) [TaxId:7460] [69389] (3 PDB entries)
  8. 2083539Domain d1fcqa_: 1fcq A: [65006]

Details for d1fcqa_

PDB Entry: 1fcq (more details), 1.6 Å

PDB Description: crystal structure (monoclinic) of bee venom hyaluronidase
PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d1fcqa_:

Sequence, based on SEQRES records: (download)

>d1fcqa_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera) [TaxId: 7460]}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkdpng
nvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpy
kklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypyc
ynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkeal
riarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddint
kakclqfreylnnelgpavkr

Sequence, based on observed residues (ATOM records): (download)

>d1fcqa_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera) [TaxId: 7460]}
efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallvarng
gvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpykklsvev
vrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypycynltpnq
psaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkealriarqmt
tsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddintkakclqf
reylnnelgpavkr

SCOPe Domain Coordinates for d1fcqa_:

Click to download the PDB-style file with coordinates for d1fcqa_.
(The format of our PDB-style files is described here.)

Timeline for d1fcqa_: