Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Graylag goose (Anser anser) [TaxId:8843] [68940] (1 PDB entry) |
Domain d1fawd_: 1faw D: [65005] Other proteins in same PDB: d1fawa_, d1fawc_ complexed with hem, oxy |
PDB Entry: 1faw (more details), 3.09 Å
SCOPe Domain Sequences for d1fawd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fawd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Graylag goose (Anser anser) [TaxId: 8843]} vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak eftpecqaawqklvrvvahalarkyh
Timeline for d1fawd_: