Lineage for d1fawd_ (1faw D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759079Species Graylag goose (Anser anser) [TaxId:8843] [68940] (1 PDB entry)
  8. 759081Domain d1fawd_: 1faw D: [65005]
    Other proteins in same PDB: d1fawa_, d1fawc_
    complexed with hem, oxy

Details for d1fawd_

PDB Entry: 1faw (more details), 3.09 Å

PDB Description: graylag goose hemoglobin (oxy form)
PDB Compounds: (D:) hemoglobin (beta subunit)

SCOP Domain Sequences for d1fawd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fawd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Graylag goose (Anser anser) [TaxId: 8843]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpecqaawqklvrvvahalarkyh

SCOP Domain Coordinates for d1fawd_:

Click to download the PDB-style file with coordinates for d1fawd_.
(The format of our PDB-style files is described here.)

Timeline for d1fawd_: