Lineage for d1fawd_ (1faw D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93770Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 93804Species Graylag goose (Anser anser) [TaxId:8843] [68940] (1 PDB entry)
  8. 93806Domain d1fawd_: 1faw D: [65005]
    Other proteins in same PDB: d1fawa_, d1fawc_

Details for d1fawd_

PDB Entry: 1faw (more details), 3.09 Å

PDB Description: graylag goose hemoglobin (oxy form)

SCOP Domain Sequences for d1fawd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fawd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Graylag goose (Anser anser)}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpecqaawqklvrvvahalarkyh

SCOP Domain Coordinates for d1fawd_:

Click to download the PDB-style file with coordinates for d1fawd_.
(The format of our PDB-style files is described here.)

Timeline for d1fawd_: