Lineage for d1f9nf2 (1f9n F:79-149)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413929Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 413966Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) (S)
    forms trimers with three closely packed beta-sheets
  5. 413967Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
  6. 413968Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 413979Species Bacillus subtilis [TaxId:1423] [69759] (1 PDB entry)
  8. 413985Domain d1f9nf2: 1f9n F:79-149 [65001]
    Other proteins in same PDB: d1f9na1, d1f9nb1, d1f9nc1, d1f9nd1, d1f9ne1, d1f9nf1

Details for d1f9nf2

PDB Entry: 1f9n (more details), 2.7 Å

PDB Description: crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis

SCOP Domain Sequences for d1f9nf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9nf2 d.74.2.1 (F:79-149) C-terminal domain of arginine repressor {Bacillus subtilis}
almdafvkidsashmivlktmpgnaqaigalmdnldwdemmgticgddtiliicrtpedt
egvknrllell

SCOP Domain Coordinates for d1f9nf2:

Click to download the PDB-style file with coordinates for d1f9nf2.
(The format of our PDB-style files is described here.)

Timeline for d1f9nf2: