SCOP 1.67: Domain d1f9ne2: 1f9n E:79-149

Lineage for d1f9ne2 (1f9n E:79-149)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)

6. Protein C-terminal domain of arginine repressor [55254] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [69759] (1 PDB entry)

8. Domain d1f9ne2: 1f9n E:79-149 [64999]
   Other proteins in same PDB: d1f9na1, d1f9nb1, d1f9nc1, d1f9nd1, d1f9ne1, d1f9nf1

Details for d1f9ne2

PDB Entry: 1f9n, 2.7 Å

PDB Description: crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis

SCOP Domain Sequences for d1f9ne2:

Sequence; same for both SEQRES and ATOM records:

>d1f9ne2 d.74.2.1 (E:79-149) C-terminal domain of arginine repressor {Bacillus subtilis}
almdafvkidsashmivlktmpgnaqaigalmdnldwdemmgticgddtiliicrtpedt
egvknrllell

Timeline for d1f9ne2:

• d1f9ne2 first appeared in SCOP 1.59
  
• d1f9ne2 appears in SCOP 1.65
  
• d1f9ne2 appears in SCOP 1.69
  
• d1f9ne2 appears in the current release, SCOPe 2.08