SCOP 1.67: Domain d1f9nb1: 1f9n B:1-78

Lineage for d1f9nb1 (1f9n B:1-78)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein)

6. Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [68966] (1 PDB entry)

8. Domain d1f9nb1: 1f9n B:1-78 [64992]
   Other proteins in same PDB: d1f9na2, d1f9nb2, d1f9nc2, d1f9nd2, d1f9ne2, d1f9nf2

Details for d1f9nb1

PDB Entry: 1f9n, 2.7 Å

PDB Description: crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis

SCOP Domain Sequences for d1f9nb1:

Sequence; same for both SEQRES and ATOM records:

>d1f9nb1 a.4.5.3 (B:1-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis}
mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
kyslpadqrfnplsklkr

Timeline for d1f9nb1:

• d1f9nb1 first appeared in SCOP 1.59
  
• d1f9nb1 appears in SCOP 1.65
  
• d1f9nb1 appears in SCOP 1.69
  
• d1f9nb1 appears in the current release, SCOPe 2.08