SCOPe 2.01: Domain d1f44a1: 1f44 A:20-129

Lineage for d1f44a1 (1f44 A:20-129)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d1f44a1: 1f44 A:20-129 [64982]
   Other proteins in same PDB: d1f44a2
   protein/DNA complex

Details for d1f44a1

PDB Entry: 1f44, 2.05 Å

PDB Description: crystal structure of trimeric cre recombinase-lox complex

PDB Compounds: (A:) cre recombinase

SCOPe Domain Sequences for d1f44a1:

Sequence; same for both SEQRES and ATOM records:

>d1f44a1 a.60.9.1 (A:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d1f44a1:

• d1f44a1 first appeared in SCOP 1.59
  
• d1f44a1 appears in SCOP 1.75
  
• d1f44a1 appears in SCOPe 2.02
  
• d1f44a1 appears in the current release, SCOPe 2.08