Lineage for d1f3xh2 (1f3x H:12-115,H:218-395)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117377Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 117378Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 117379Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 117409Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (6 PDB entries)
  8. 117441Domain d1f3xh2: 1f3x H:12-115,H:218-395 [64980]
    Other proteins in same PDB: d1f3xa1, d1f3xa3, d1f3xb1, d1f3xb3, d1f3xc1, d1f3xc3, d1f3xd1, d1f3xd3, d1f3xe1, d1f3xe3, d1f3xf1, d1f3xf3, d1f3xg1, d1f3xg3, d1f3xh1, d1f3xh3

Details for d1f3xh2

PDB Entry: 1f3x (more details), 2.8 Å

PDB Description: s402p mutant of rabbit muscle pyruvate kinase

SCOP Domain Sequences for d1f3xh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3xh2 c.1.12.1 (H:12-115,H:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1f3xh2:

Click to download the PDB-style file with coordinates for d1f3xh2.
(The format of our PDB-style files is described here.)

Timeline for d1f3xh2: