SCOPe 2.02: Domain d1f3xg3: 1f3x G:396-530

Lineage for d1f3xg3 (1f3x G:396-530)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)

6. Protein Pyruvate kinase, C-terminal domain [52937] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries)

8. Domain d1f3xg3: 1f3x G:396-530 [64978]
   Other proteins in same PDB: d1f3xa1, d1f3xa2, d1f3xb1, d1f3xb2, d1f3xc1, d1f3xc2, d1f3xd1, d1f3xd2, d1f3xe1, d1f3xe2, d1f3xf1, d1f3xf2, d1f3xg1, d1f3xg2, d1f3xh1, d1f3xh2
   complexed with k, mn, pyr; mutant

Details for d1f3xg3

PDB Entry: 1f3x, 2.8 Å

PDB Description: s402p mutant of rabbit muscle pyruvate kinase

PDB Compounds: (G:) pyruvate kinase

SCOPe Domain Sequences for d1f3xg3:

Sequence; same for both SEQRES and ATOM records:

>d1f3xg3 c.49.1.1 (G:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elarasphstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

Timeline for d1f3xg3:

• d1f3xg3 first appeared in SCOP 1.59
  
• d1f3xg3 appears in SCOPe 2.01
  
• d1f3xg3 appears in SCOPe 2.03
  
• d1f3xg3 appears in the current release, SCOPe 2.08