SCOP 1.61: Domain d1f3xb3: 1f3x B:396-530

Lineage for d1f3xb3 (1f3x B:396-530)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)

4. Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)

6. Protein Pyruvate kinase, C-terminal domain [52937] (5 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (6 PDB entries)

8. Domain d1f3xb3: 1f3x B:396-530 [64963]
   Other proteins in same PDB: d1f3xa1, d1f3xa2, d1f3xb1, d1f3xb2, d1f3xc1, d1f3xc2, d1f3xd1, d1f3xd2, d1f3xe1, d1f3xe2, d1f3xf1, d1f3xf2, d1f3xg1, d1f3xg2, d1f3xh1, d1f3xh2

Details for d1f3xb3

PDB Entry: 1f3x, 2.8 Å

PDB Description: s402p mutant of rabbit muscle pyruvate kinase

SCOP Domain Sequences for d1f3xb3:

Sequence; same for both SEQRES and ATOM records:

>d1f3xb3 c.49.1.1 (B:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
elarasphstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

Timeline for d1f3xb3:

• d1f3xb3 first appeared in SCOP 1.59
  
• d1f3xb3 appears in SCOP 1.63
  
• d1f3xb3 appears in the current release, SCOPe 2.08