SCOP 1.59: Domain d1f3xb1: 1f3x B:116-217

Lineage for d1f3xb1 (1f3x B:116-217)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)

6. Protein Pyruvate kinase (PK) [50802] (5 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (6 PDB entries)

8. Domain d1f3xb1: 1f3x B:116-217 [64961]
   Other proteins in same PDB: d1f3xa2, d1f3xa3, d1f3xb2, d1f3xb3, d1f3xc2, d1f3xc3, d1f3xd2, d1f3xd3, d1f3xe2, d1f3xe3, d1f3xf2, d1f3xf3, d1f3xg2, d1f3xg3, d1f3xh2, d1f3xh3

Details for d1f3xb1

PDB Entry: 1f3x, 2.8 Å

PDB Description: s402p mutant of rabbit muscle pyruvate kinase

SCOP Domain Sequences for d1f3xb1:

Sequence; same for both SEQRES and ATOM records:

>d1f3xb1 b.58.1.1 (B:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

Timeline for d1f3xb1:

• d1f3xb1 is new in SCOP 1.59
  
• d1f3xb1 appears in SCOP 1.61
  
• d1f3xb1 appears in the current release, SCOPe 2.08