Lineage for d1f3xa3 (1f3x A:396-530)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585557Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 585558Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 585559Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 585560Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 585607Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (6 PDB entries)
  8. 585624Domain d1f3xa3: 1f3x A:396-530 [64960]
    Other proteins in same PDB: d1f3xa1, d1f3xa2, d1f3xb1, d1f3xb2, d1f3xc1, d1f3xc2, d1f3xd1, d1f3xd2, d1f3xe1, d1f3xe2, d1f3xf1, d1f3xf2, d1f3xg1, d1f3xg2, d1f3xh1, d1f3xh2

Details for d1f3xa3

PDB Entry: 1f3x (more details), 2.8 Å

PDB Description: s402p mutant of rabbit muscle pyruvate kinase

SCOP Domain Sequences for d1f3xa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3xa3 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
elarasphstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOP Domain Coordinates for d1f3xa3:

Click to download the PDB-style file with coordinates for d1f3xa3.
(The format of our PDB-style files is described here.)

Timeline for d1f3xa3: