Lineage for d1f3wf2 (1f3w F:12-115,F:218-395)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117377Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 117378Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 117379Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 117409Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (6 PDB entries)
  8. 117448Domain d1f3wf2: 1f3w F:12-115,F:218-395 [64950]
    Other proteins in same PDB: d1f3wa1, d1f3wa3, d1f3wb1, d1f3wb3, d1f3wc1, d1f3wc3, d1f3wd1, d1f3wd3, d1f3we1, d1f3we3, d1f3wf1, d1f3wf3, d1f3wg1, d1f3wg3, d1f3wh1, d1f3wh3

Details for d1f3wf2

PDB Entry: 1f3w (more details), 3 Å

PDB Description: recombinant rabbit muscle pyruvate kinase
PDB Compounds: (F:)

SCOP Domain Sequences for d1f3wf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3wf2 c.1.12.1 (F:12-115,F:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1f3wf2:

Click to download the PDB-style file with coordinates for d1f3wf2.
(The format of our PDB-style files is described here.)

Timeline for d1f3wf2: