Lineage for d1f3we1 (1f3w E:116-217)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113337Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 113338Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 113339Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 113340Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 113370Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (6 PDB entries)
  8. 113408Domain d1f3we1: 1f3w E:116-217 [64946]
    Other proteins in same PDB: d1f3wa2, d1f3wa3, d1f3wb2, d1f3wb3, d1f3wc2, d1f3wc3, d1f3wd2, d1f3wd3, d1f3we2, d1f3we3, d1f3wf2, d1f3wf3, d1f3wg2, d1f3wg3, d1f3wh2, d1f3wh3

Details for d1f3we1

PDB Entry: 1f3w (more details), 3 Å

PDB Description: recombinant rabbit muscle pyruvate kinase

SCOP Domain Sequences for d1f3we1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3we1 b.58.1.1 (E:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOP Domain Coordinates for d1f3we1:

Click to download the PDB-style file with coordinates for d1f3we1.
(The format of our PDB-style files is described here.)

Timeline for d1f3we1: