Lineage for d1f3wd2 (1f3w D:12-115,D:218-395)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174373Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 174374Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 174375Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 174405Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (6 PDB entries)
  8. 174442Domain d1f3wd2: 1f3w D:12-115,D:218-395 [64944]
    Other proteins in same PDB: d1f3wa1, d1f3wa3, d1f3wb1, d1f3wb3, d1f3wc1, d1f3wc3, d1f3wd1, d1f3wd3, d1f3we1, d1f3we3, d1f3wf1, d1f3wf3, d1f3wg1, d1f3wg3, d1f3wh1, d1f3wh3

Details for d1f3wd2

PDB Entry: 1f3w (more details), 3 Å

PDB Description: recombinant rabbit muscle pyruvate kinase
PDB Compounds: (D:)

SCOP Domain Sequences for d1f3wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3wd2 c.1.12.1 (D:12-115,D:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1f3wd2:

Click to download the PDB-style file with coordinates for d1f3wd2.
(The format of our PDB-style files is described here.)

Timeline for d1f3wd2: