Lineage for d1f20a2 (1f20 A:1233-1397)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) 
binds NADP differently than classical Rossmann-fold
N-terminal FAD-linked domain contains (6,10) barrel
Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins) 
Protein Neuronal nitric-oxide synthase FAD/NADP+ domain [69451] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [69452] (2 PDB entries)
Uniprot P29476 750-1413
Domain d1f20a2: 1f20 A:1233-1397 [64933]
Other proteins in same PDB: d1f20a1
complexed with fad, fmt, gol, nap
Details for d1f20a2
PDB Entry: 1f20 (more details), 1.9 Å
PDB Description: crystal structure of rat neuronal nitric-oxide synthase fad/nadp+ domain at 1.9a resolution.
PDB Compounds: (A:) Nitric-oxide synthaseSCOPe Domain Sequences for d1f20a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpmvlvfgcrqskidhiy
reetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyralkeqgghiyvcgdv
tmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgv
SCOPe Domain Coordinates for d1f20a2:
Click to download the PDB-style file with coordinates for d1f20a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f20a2:
- d1f20a2 first appeared in SCOP 1.59
- d1f20a2 appears in SCOPe 2.06
- d1f20a2 appears in the current release, SCOPe 2.08
View in 3D
