Lineage for d1f20a2 (1f20 A:1233-1397)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins) Protein Neuronal nitric-oxide synthase FAD/NADP+ domain [69451] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [69452] (1 PDB entry) 
Domain d1f20a2: 1f20 A:1233-1397 [64933]
Other proteins in same PDB: d1f20a1
Details for d1f20a2
PDB Entry: 1f20 (more details), 1.9 Å
PDB Description: crystal structure of rat neuronal nitric-oxide synthase fad/nadp+ domain at 1.9a resolution.
SCOP Domain Sequences for d1f20a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus)}
sfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpmvlvfgcrqskidhiy
reetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyralkeqgghiyvcgdv
tmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgv
SCOP Domain Coordinates for d1f20a2:
Click to download the PDB-style file with coordinates for d1f20a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f20a2:
- d1f20a2 is new in SCOP 1.59
- d1f20a2 appears in SCOP 1.61
- d1f20a2 appears in the current release, SCOPe 2.08
View in 3D
