Lineage for d1f20a2 (1f20 A:1233-1397)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859873Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins)
  6. 2859884Protein Neuronal nitric-oxide synthase FAD/NADP+ domain [69451] (1 species)
  7. 2859885Species Norway rat (Rattus norvegicus) [TaxId:10116] [69452] (2 PDB entries)
    Uniprot P29476 750-1413
  8. 2859886Domain d1f20a2: 1f20 A:1233-1397 [64933]
    Other proteins in same PDB: d1f20a1
    complexed with fad, fmt, gol, nap

Details for d1f20a2

PDB Entry: 1f20 (more details), 1.9 Å

PDB Description: crystal structure of rat neuronal nitric-oxide synthase fad/nadp+ domain at 1.9a resolution.
PDB Compounds: (A:) Nitric-oxide synthase

SCOPe Domain Sequences for d1f20a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpmvlvfgcrqskidhiy
reetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyralkeqgghiyvcgdv
tmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgv

SCOPe Domain Coordinates for d1f20a2:

Click to download the PDB-style file with coordinates for d1f20a2.
(The format of our PDB-style files is described here.)

Timeline for d1f20a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f20a1