Lineage for d1f1sa4 (1f1s A:620-911)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1535067Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1535274Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
    automatically mapped to Pfam PF02278
  6. 1535292Protein Hyaluronate lyase [50009] (2 species)
  7. 1535313Species Streptococcus agalactiae [TaxId:1311] [69241] (3 PDB entries)
  8. 1535314Domain d1f1sa4: 1f1s A:620-911 [64931]
    Other proteins in same PDB: d1f1sa1, d1f1sa2, d1f1sa3

Details for d1f1sa4

PDB Entry: 1f1s (more details), 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1f1sa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1sa4 b.30.5.2 (A:620-911) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkefmskhskdakektgqvtgtsdfvgsv
klndhfalaamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkdds
ktpyttyvngktidlkqassqqftdtksvfleskepgrnigyiffknstidierkeqtgt
wnsinrtskntsivsnpfitisqkhdnkgdsygymmvpnidrtsfdklansk

SCOPe Domain Coordinates for d1f1sa4:

Click to download the PDB-style file with coordinates for d1f1sa4.
(The format of our PDB-style files is described here.)

Timeline for d1f1sa4: