Lineage for d1f1sa4 (1f1s A:620-919)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165166Superfamily b.30.5: Galactose mutarotase-like [74650] (4 families) (S)
  5. 165294Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (2 proteins)
  6. 165302Protein Hyaluronate lyase [50009] (2 species)
  7. 165303Species Streptococcus agalactiae [TaxId:1311] [69241] (2 PDB entries)
  8. 165304Domain d1f1sa4: 1f1s A:620-919 [64931]
    Other proteins in same PDB: d1f1sa1, d1f1sa2, d1f1sa3

Details for d1f1sa4

PDB Entry: 1f1s (more details), 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.

SCOP Domain Sequences for d1f1sa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1sa4 b.30.5.2 (A:620-919) Hyaluronate lyase {Streptococcus agalactiae}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkefmskhskdakektgqvtgtsdfvgsv
klndhfalaamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkdds
ktpyttyvngktidlkqassqqftdtksvfleskepgrnigyiffknstidierkeqtgt
wnsinrtskntsivsnpfitisqkhdnkgdsygymmvpnidrtsfdklanskevellens

SCOP Domain Coordinates for d1f1sa4:

Click to download the PDB-style file with coordinates for d1f1sa4.
(The format of our PDB-style files is described here.)

Timeline for d1f1sa4: