Lineage for d1f1sa3 (1f1s A:912-984)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793854Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 793855Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 793856Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 793874Protein Hyaluronate lyase [49867] (2 species)
  7. 793875Species Streptococcus agalactiae [TaxId:1311] [69232] (3 PDB entries)
  8. 793876Domain d1f1sa3: 1f1s A:912-984 [64930]
    Other proteins in same PDB: d1f1sa1, d1f1sa2, d1f1sa4

Details for d1f1sa3

PDB Entry: 1f1s (more details), 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.
PDB Compounds: (A:) hyaluronate lyase

SCOP Domain Sequences for d1f1sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1sa3 b.24.1.1 (A:912-984) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
evellensskqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvyy
qpqtmtktdqlai

SCOP Domain Coordinates for d1f1sa3:

Click to download the PDB-style file with coordinates for d1f1sa3.
(The format of our PDB-style files is described here.)

Timeline for d1f1sa3: