Lineage for d1f1sa3 (1f1s A:912-984)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294342Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 294343Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 294344Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 294355Protein Hyaluronate lyase [49867] (2 species)
  7. 294356Species Streptococcus agalactiae [TaxId:1311] [69232] (3 PDB entries)
  8. 294357Domain d1f1sa3: 1f1s A:912-984 [64930]
    Other proteins in same PDB: d1f1sa1, d1f1sa2, d1f1sa4

Details for d1f1sa3

PDB Entry: 1f1s (more details), 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.

SCOP Domain Sequences for d1f1sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1sa3 b.24.1.1 (A:912-984) Hyaluronate lyase {Streptococcus agalactiae}
evellensskqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvyy
qpqtmtktdqlai

SCOP Domain Coordinates for d1f1sa3:

Click to download the PDB-style file with coordinates for d1f1sa3.
(The format of our PDB-style files is described here.)

Timeline for d1f1sa3: