SCOPe 2.03: Domain d1f1sa2: 1f1s A:171-248

Lineage for d1f1sa2 (1f1s A:171-248)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Hyaluronate lyase precatalytic domain [69167] (1 species)
   precedes the catalytic incomplete alpha5/alpha5 barrel
   a rudiment form of Ig-like domain

7. Species Streptococcus agalactiae [TaxId:1311] [69168] (3 PDB entries)

8. Domain d1f1sa2: 1f1s A:171-248 [64929]
   Other proteins in same PDB: d1f1sa1, d1f1sa3, d1f1sa4

Details for d1f1sa2

PDB Entry: 1f1s, 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.

PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1f1sa2:

Sequence; same for both SEQRES and ATOM records:

>d1f1sa2 b.1.18.2 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae [TaxId: 1311]}
sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
dksgkiikevplsvtast

Timeline for d1f1sa2:

• d1f1sa2 first appeared in SCOP 1.59
  
• d1f1sa2 appears in SCOPe 2.02
  
• d1f1sa2 appears in SCOPe 2.04
  
• d1f1sa2 appears in the current release, SCOPe 2.08