Lineage for d1f1sa2 (1f1s A:171-248)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789214Protein Hyaluronate lyase precatalytic domain [69167] (1 species)
    precedes the catalytic incomplete alpha5/alpha5 barrel
    a rudiment form of Ig-like domain
  7. 789215Species Streptococcus agalactiae [TaxId:1311] [69168] (3 PDB entries)
  8. 789216Domain d1f1sa2: 1f1s A:171-248 [64929]
    Other proteins in same PDB: d1f1sa1, d1f1sa3, d1f1sa4

Details for d1f1sa2

PDB Entry: 1f1s (more details), 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.
PDB Compounds: (A:) hyaluronate lyase

SCOP Domain Sequences for d1f1sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1sa2 b.1.18.2 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae [TaxId: 1311]}
sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
dksgkiikevplsvtast

SCOP Domain Coordinates for d1f1sa2:

Click to download the PDB-style file with coordinates for d1f1sa2.
(The format of our PDB-style files is described here.)

Timeline for d1f1sa2: