Lineage for d1f1sa2 (1f1s A:171-248)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (25 proteins) 
Protein Hyaluronate lyase precatalytic domain [69167] (1 species) Species Streptococcus agalactiae [TaxId:1311] [69168] (2 PDB entries) 
Domain d1f1sa2: 1f1s A:171-248 [64929]
Other proteins in same PDB: d1f1sa1, d1f1sa3, d1f1sa4
Details for d1f1sa2
PDB Entry: 1f1s (more details), 2.1 Å
PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.
SCOP Domain Sequences for d1f1sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1sa2 b.1.1.5 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae}
sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
dksgkiikevplsvtast
SCOP Domain Coordinates for d1f1sa2:
Click to download the PDB-style file with coordinates for d1f1sa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f1sa2:
- d1f1sa2 is new in SCOP 1.59
- d1f1sa2 appears in SCOP 1.61
- d1f1sa2 appears in the current release, SCOPe 2.08
View in 3D
