Lineage for d1f1sa2 (1f1s A:171-248)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105102Protein Hyaluronate lyase precatalytic domain [69167] (1 species)
  7. 105103Species Streptococcus agalactiae [TaxId:1311] [69168] (2 PDB entries)
  8. 105104Domain d1f1sa2: 1f1s A:171-248 [64929]
    Other proteins in same PDB: d1f1sa1, d1f1sa3, d1f1sa4

Details for d1f1sa2

PDB Entry: 1f1s (more details), 2.1 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase at 2.1 angstrom resolution.

SCOP Domain Sequences for d1f1sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1sa2 b.1.1.5 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae}
sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
dksgkiikevplsvtast

SCOP Domain Coordinates for d1f1sa2:

Click to download the PDB-style file with coordinates for d1f1sa2.
(The format of our PDB-style files is described here.)

Timeline for d1f1sa2: